PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G210300.1.p
Common NameGLYMA_05G210300, LOC100787954
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 636aa    MW: 71175.8 Da    PI: 6.6482
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G210300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox261.6e-084404771954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps  ++  LA++ gL+ rqV++WF N R +
  Glyma.05G210300.1.p 440 FEHflHPYPSDVDKHILARQAGLSRRQVSNWFINARVR 477
                          554459******************************88 PP

2BELL114.36.3e-37301370372
                 BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                           elqk+k+kLl +leeVd+rYk+y++q+++v+ssFeavag g+a++Y +lAlka+SrhFrcLkd i++ i
  Glyma.05G210300.1.p 301 VELQKRKTKLLAMLEEVDRRYKHYRNQMKAVVSSFEAVAGNGAATVYSALALKAMSRHFRCLKDGIMDEI 370
                          699***************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.7E-54235368IPR006563POX domain
PfamPF075269.4E-47241366IPR006563POX domain
PROSITE profilePS5007112.195418481IPR001356Homeobox domain
CDDcd000867.42E-11421482No hitNo description
SMARTSM003895.6E-8421485IPR001356Homeobox domain
SuperFamilySSF466891.88E-16422487IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-26424487IPR009057Homeodomain-like
PfamPF059204.9E-17438477IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MARQLCEEKS KDMASSSHGL FYSDVSSNNP TIQPHLMNHI QGFVTDPDMF NLTTGMDMIG  60
FSKNLQQHSE SNGVMMWKSF FGKPGQLAGS SSSKTMNGSC SNFYNQHADA YNTNKQDFTS  120
GISETSSENL VVGGAHDSAP WQENRLMVDD SSLRCVFPCE GNQRPSQGLS LSLSSTNPLS  180
IGLQSFELRQ TSHHQHLSDF VSREGFFGKP VNAQQQQQQM LQDGYLSPSK GANIYQGHFL  240
IKNSKFLVPA QVLLNEFCSL GTKENDVLPK QKCSQKNKQW EEGNSGGGSS KNHSLSSLEY  300
VELQKRKTKL LAMLEEVDRR YKHYRNQMKA VVSSFEAVAG NGAATVYSAL ALKAMSRHFR  360
CLKDGIMDEI EATRKGMGEK DHVAAVPGTT RGETPRLRIV DQSLRQQRAF QQISIMETHP  420
WRPQRGLPER SVSVLRAWLF EHFLHPYPSD VDKHILARQA GLSRRQVSNW FINARVRLWK  480
PMVEEMYLEE EKEQENDVAS SDINVPEEDE KPTQEAPLLR IDSECMSSIV NDVTKSGKTI  540
QNDNQMDAFG SVELDFSSYT HAHHSSGVSL TLGLQQHGES GVSLAFLPAA TQSSMFYPRD  600
QIQECQTVQY SLLDAEGQNM PFRNVMGTHL LHDLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B5e-15427484158Homeobox protein Meis1
4xrs_A5e-15427484158Homeobox protein Meis1
4xrm_B6e-15427485563Homeobox protein Meis2
4xrm_A6e-15427485563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.52100.0cotyledon| hypocotyl| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006580559.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_006580558.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_006580557.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-134BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLI1K6F50.0I1K6F5_SOYBN; Uncharacterized protein
STRINGGLYMA05G37550.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-122TALE family protein